PTPN14 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an N-terminal noncatalytic domain similar to that of band 4.1 superfamily cytoskeleton-associated proteins, which suggested the membrane or cytoskeleton localization of this protein. It appears to regulate lymphatic development in mammals, and a loss of function mutation has been found in a kindred with a lymphedema-choanal atresia.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of mouse PTPN14

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: HVQCSEHYSETHTSQDSIFPGNEEALYCRSHNSLDLNYLNGTVTNGSVCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tyrosine-protein phosphatase non-receptor type 14

Protein Size: 472

Purification: Affinity Purified

• SKU: AVIARP56641_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56641_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5784
• Host: Rabbit