Ptprc Antibody - middle region : FITC

Ptprc Antibody - middle region : FITC
SKU
AVIARP59108_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ptprc is a member of a family of heavily glycosylated leukocyte cell surface glycoproteins; It displays extensive O-glycosylation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Ptprc

Molecular Weight: 140kDa

Peptide Sequence: Synthetic peptide located within the following region: FLVFLIIVTSIALLVVLYKIYDLRKKRSSNLDEQQELVERDEEKQLINVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Receptor-type tyrosine-protein phosphatase C

Protein Size: 1273

Purification: Affinity Purified
More Information
SKU AVIARP59108_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59108_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 24699
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×