PTX3 Antibody - N-terminal region : FITC

PTX3 Antibody - N-terminal region : FITC
SKU
AVIARP56497_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PTX3 plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTX3

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pentraxin-related protein PTX3

Protein Size: 381

Purification: Affinity Purified
More Information
SKU AVIARP56497_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56497_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5806
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×