PTX3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PTX3 plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTX3

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pentraxin-related protein PTX3

Protein Size: 381

Purification: Affinity Purified

• SKU: AVIARP56497_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56497_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5806
• Host: Rabbit