PYCR2 Antibody - middle region : FITC

PYCR2 Antibody - middle region : FITC
SKU
AVIARP54937_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR2

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyrroline-5-carboxylate reductase 2

Protein Size: 320

Purification: Affinity Purified
More Information
SKU AVIARP54937_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54937_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Immunoprecipitation, Western Blotting, Immunohistochemistry
Human Gene ID 29920
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×