PYDC1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: PYDC1 associates with apoptosis-associated specklike protein containing a CARD domain (ASC) and modulates its ability to collaborate with pyrin and cryopyrin in NF-kappa-B and pro- caspase-1 activation. It suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PYDC1

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: REAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyrin domain-containing protein 1

Protein Size: 89

Purification: Affinity Purified

• SKU: AVIARP55560_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55560_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 260434
• Host: Rabbit