QARS Antibody - N-terminal region : FITC

QARS Antibody - N-terminal region : FITC
SKU
AVIARP56628_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tRNA synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a multienzyme complex. Although present in eukaryotes, glutaminyl-tRNA synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tRNA(Gln) is formed by transamidation of the misacylated Glu-tRNA(Gln). Glutaminyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human QARS

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutamine--tRNA ligase

Protein Size: 775

Purification: Affinity Purified
More Information
SKU AVIARP56628_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56628_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5859
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×