R3HDM2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human R3HDM2

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: R3H domain-containing protein 2

Protein Size: 637

Purification: Affinity Purified

• SKU: AVIARP55106_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55106_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22864
• Host: Rabbit