RAB11FIP2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB11FIP2

Molecular Weight: 58

Peptide Sequence: Synthetic peptide located within the following region: LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rab11 family-interacting protein 2

Protein Size: 512

Purification: Affinity Purified

• SKU: AVIARP55095_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55095_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22841
• Host: Rabbit