RAB11FIP5 Antibody - N-terminal region : Biotin

RAB11FIP5 Antibody - N-terminal region : Biotin
SKU
AVIARP55260_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RAB11FIP5 is a Rab effector involved in protein trafficking from apical recycling endosomes to the apical plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB11FIP5

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rab11 family-interacting protein 5

Protein Size: 653

Purification: Affinity Purified
More Information
SKU AVIARP55260_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55260_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26056
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×