RAB1A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB1A

Key Reference: Diao,A., (2008) J. Biol. Chem. 283 (11), 6957-6967

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-1A

Protein Size: 205

Purification: Affinity Purified

• SKU: AVIARP56561_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56561_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 5861
• Host: Rabbit