RAB21 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB21

Key Reference: N/A

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: SYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-21

Protein Size: 225

Purification: Affinity purified

• SKU: AVIARP55140_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55140_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23011
• Host: Rabbit