RAB27A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscell

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB27A

Key Reference: Chiaverini,C., (2008) J. Biol. Chem. 283 (18), 12635-12642

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-27A

Protein Size: 221

Purification: Affinity Purified

• SKU: AVIARP56591_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56591_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5873
• Host: Rabbit