RAB39 Antibody - N-terminal region : Biotin

RAB39 Antibody - N-terminal region : Biotin
SKU
AVIARP56965_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RAB39 may be involved in vesicular trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB39

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-39A

Protein Size: 217

Purification: Affinity Purified
More Information
SKU AVIARP56965_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56965_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54734
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×