RAB5B Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAB5B play a role in protein transport. RAB5B is probably involved in vesicular traffic.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB5B

Key Reference: Hirota,Y., (2007) Biochem. Biophys. Res. Commun. 364 (1), 40-47

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-5B

Protein Size: 215

Purification: Affinity Purified

• SKU: AVIARP56499_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56499_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 5869
• Host: Rabbit