Rab9b Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Rab9b may be involved in the transport of proteins between the endosomes and the trans Golgi network.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-9B

Protein Size: 201

Purification: Affinity Purified

• SKU: AVIARP56895_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56895_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 319642
• Host: Rabbit