RABGEF1 Antibody - N-terminal region : HRP

RABGEF1 Antibody - N-terminal region : HRP
SKU
AVIARP55073_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RABGEF1 forms a complex with rabaptin-5 (RABPT5; MIM 603616) that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5 (RAB5A; MIM 179512) (Horiuchi et al., 1997 [PubMed 9323142]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RABGEF1

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ75284, highly similar to Homo sapiens RAB guanine nucleotide exchange factor (GEF) 1 (RABGEF1), mRNA EMBL BAF83367.1

Protein Size: 491

Purification: Affinity Purified
More Information
SKU AVIARP55073_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55073_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27342
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×