RAD1 Antibody - middle region : FITC

RAD1 Antibody - middle region : FITC
SKU
AVIARP57717_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD1

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: ITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cell cycle checkpoint protein RAD1

Protein Size: 282

Purification: Affinity Purified
More Information
SKU AVIARP57717_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57717_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5810
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×