Rad21 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Rad21 Ensembl ENSRNOP00000006209

Protein Size: 635

Purification: Affinity Purified

• SKU: AVIARP56709_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56709_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 314949
• Host: Rabbit