RAD23B Antibody - middle region : FITC

RAD23B Antibody - middle region : FITC
SKU
AVIARP56506_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD23B

Key Reference: Lin,J., (2007) Cancer Epidemiol. Biomarkers Prev. 16 (10), 2065-2071

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UV excision repair protein RAD23 homolog B

Protein Size: 409

Purification: Affinity Purified
More Information
SKU AVIARP56506_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56506_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5887
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×