RAI14 Antibody - middle region : FITC

RAI14 Antibody - middle region : FITC
SKU
AVIARP55286_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAI14

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: ELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankycorbin

Protein Size: 980

Purification: Affinity Purified
More Information
SKU AVIARP55286_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55286_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26064
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×