RALA Antibody - middle region : Biotin

RALA Antibody - middle region : Biotin
SKU
AVIARP56643_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RALA

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Ral-A

Protein Size: 206

Purification: Affinity Purified
More Information
SKU AVIARP56643_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56643_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5898
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×