RAN Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The RAN protein is also involved in control of DNA synthesis an

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAN

Key Reference: Abe,H., (2008) Int. J. Cancer 122 (10), 2391-2397

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding nuclear protein Ran

Protein Size: 216

Purification: Affinity Purified

• SKU: AVIARP56714_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56714_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5901
• Host: Rabbit