RANBP3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RANBP3

Key Reference: Yoon,S.O., (2008) Mol. Cell 29 (3), 362-375

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ran-binding protein 3

Protein Size: 567

Purification: Affinity Purified

• SKU: AVIARP58520_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58520_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 8498
• Host: Rabbit
• Conjugate: Conjugated, Biotin