Rap1a Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rap1a induces morphological reversion of a cell line transformed by a Ras oncogene. Rap1a counteracts the mitogenic function of Ras, at least partly because it can interact with Ras GAPs and RAF in a competitive manner.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Rap1a

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: DLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rap-1A

Protein Size: 184

Purification: Affinity Purified

• SKU: AVIARP56195_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56195_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 109905
• Host: Rabbit