RAP1GAP Antibody - middle region : Biotin

RAP1GAP Antibody - middle region : Biotin
SKU
AVIARP56511_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAP1GAP

Key Reference: Mitra,R.S., (2008) Cancer Res. 68 (10), 3959-3969

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rap1 GTPase-activating protein 1

Protein Size: 663

Purification: Affinity Purified
More Information
SKU AVIARP56511_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56511_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5909
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×