RASGEF1C Antibody - middle region : FITC

RASGEF1C Antibody - middle region : FITC
SKU
AVIARP55737_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RASGEF1C is the guanine nucleotide exchange factor (GEF).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASGEF1C

Key Reference: Bonaldo,M.F., (1996) Genome Res. 6 (9), 791-806

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-GEF domain-containing family member 1C

Protein Size: 466

Purification: Affinity Purified
More Information
SKU AVIARP55737_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55737_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 255426
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×