RASSF7 Antibody - middle region : Biotin

RASSF7 Antibody - middle region : Biotin
SKU
AVIARP58122_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASSF7

Key Reference: Sherwood,V., (2008) Mol. Biol. Cell 19 (4), 1772-1782

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras association domain-containing protein 7

Protein Size: 373

Purification: Affinity Purified
More Information
SKU AVIARP58122_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58122_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 8045
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×