RASSF7 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASSF7

Key Reference: Sherwood,V., (2008) Mol. Biol. Cell 19 (4), 1772-1782

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras association domain-containing protein 7

Protein Size: 373

Purification: Affinity Purified

• SKU: AVIARP58122_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58122_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 8045
• Host: Rabbit