RB1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RB1

Molecular Weight: 106kDa

Peptide Sequence: Synthetic peptide located within the following region: MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Retinoblastoma-associated protein

Protein Size: 928

Purification: Affinity Purified

• SKU: AVIARP58065_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58065_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5925
• Host: Rabbit