Rbbp4 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rbbp4 is a core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; and the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rbbp4

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: TAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Histone-binding protein RBBP4

Protein Size: 425

Purification: Affinity Purified

• SKU: AVIARP56649_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56649_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 19646
• Host: Rabbit