RBBP4 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP4

Key Reference: Scuto,A., (2007) Cancer Res. 67 (21), 10317-10324

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone-binding protein RBBP4

Protein Size: 425

Purification: Affinity Purified

• SKU: AVIARP56648_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56648_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5928
• Host: Rabbit