RBBP7 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded p

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBBP7

Key Reference: Thakur,A., (2007) Mol. Cancer Res. 5 (2), 171-181

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone-binding protein RBBP7

Protein Size: 425

Purification: Affinity Purified

• SKU: AVIARP56518_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56518_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5931
• Host: Rabbit