RBBP7 Antibody - N-terminal region : HRP

RBBP7 Antibody - N-terminal region : HRP
SKU
AVIARP56517_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded p

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP7

Key Reference: Thakur,A., (2007) Mol. Cancer Res. 5 (2), 171-181

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Histone-binding protein RBBP7

Protein Size: 425

Purification: Affinity Purified
More Information
SKU AVIARP56517_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56517_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5931
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×