RCAN1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RCAN1 interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RCAN1

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcipressin-1

Protein Size: 252

Purification: Affinity Purified

• SKU: AVIARP57857_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57857_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 1827
• Host: Rabbit