RCC2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RCC2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RCC2

Protein Size: 522

Purification: Affinity Purified

• SKU: AVIARP57290_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57290_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Immunoprecipitation, Western Blotting
• Human Gene ID: 55920
• Host: Rabbit