Rcc2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rcc2 is required for completion of mitosis and cytokinesis. It may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: GATNWDLIGRKEVPKQQAAYRNLGQNLWGPHRYGCLSGVRVRTVVSGSCA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RCC2

Protein Size: 520

Purification: Affinity Purified

• SKU: AVIARP57289_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57289_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 108911
• Host: Rabbit