RD3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RD3

Key Reference: Friedman,J.S., (2006) Am. J. Hum. Genet. 79 (6), 1059-1070

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RD3

Protein Size: 195

Purification: Affinity Purified

• SKU: AVIARP55856_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55856_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 343035
• Host: Rabbit