Research Areas: Others
Uniprot: A7L035
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-SUMO-tagged
Purity: Greater than 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 52.2 kDa
Gene Names: N/A
Organism: Chironex fleckeri (Box jellyfish)
Source: E.coli
Expression Region: 145-456aa
Protein Length: Partial
Target Protein Sequence: EQSDQELQEALYGVKREYAVSKAFLDGVRNETSDLSPTEVSALAANVPIYQGVRFIAMVVQRIKYIKPKTESEIKRMLTMLELFTDLCSLRDLILLDLYQLVATPGHSPNIASGIKEVSNLGREEYKKVFEDLLKNDDKETYLFLSYLYPREKNEQSRKIFNFFDLMKVKYDDRLKQDLTGVKIFSNVHWPNYFMCSSNDYLALICTKPYGSLKLDKLNDGYYSIKTTQHDPKICHRYGNYILFTHKRNDDLEKFNFVPVKLEKREIYLLSSKESPNKFAYVPQNADGALFFVDGIPSKVGYGNQGYFTLVE
Endotoxin: Not test.
Relevance: Has potent hemolytic activity. Is lethal to crayfish. Causes cutaneous inflammation in humans. May act as a pore-forming toxin, disrupting normal transmembrane ion concentration gradients in susceptible cells
Reference: "Identification, cloning and sequencing of two major venom proteins from the box jellyfish, Chironex fleckeri."Brinkman D., Burnell J.Toxicon 50:850-860(2007)
Function: Has potent hemolytic activity. Is lethal to crayfish. Causes cutaneous inflammation in humans. May act as a pore-forming toxin, disrupting normal transmembrane ion concentration gradients in susceptible cells (By similarity).
English
Deutsch
