Recombinant Human ADAM23 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75077

Gene Name: ADAM23

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Gly621

End Site: Asp710

Coverage: 0.17

Isoelectric Point: 6

Core Sequence: GSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 33%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: MDC3

Alternative protein names: Disintegrin and metalloproteinase domain-containing protein 23; ADAM 23; Metalloproteinase-like; disintegrin-like; and cysteine-rich protein 3; MDC-3

Protein name: ADAM metallopeptidase domain 23

Full length: 832 amino acids

Entry name: ADA23_HUMAN

• SKU: ASBPP-028-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-028-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 8745