Recombinant Human ADRA2C Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P18825

Gene Name: ADRA2C

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Thr241

End Site: Arg370

Coverage: 0.32

Isoelectric Point: 12

Core Sequence: TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRRRRARSSVCRR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 83%

Alternative gene names: ADRA2L2; ADRA2RL2

Alternative protein names: Alpha-2C adrenergic receptor; Alpha-2 adrenergic receptor subtype C4; Alpha-2C adrenoreceptor; Alpha-2C adrenoceptor; Alpha-2CAR

Protein name: adrenoceptor alpha 2C

Full length: 462 amino acids

Entry name: ADA2C_HUMAN

Product panel: Neuroscience Biomarkers

• SKU: ASBPP-4390-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4390-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 152