Recombinant Human ATP1A2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P50993

Gene Name: ATP1A2

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Pro11

End Site: Pro80

Coverage: 0.07

Isoelectric Point: 7.5

Core Sequence: PAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVLARDGPNALTP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: KIAA0778

Alternative protein names: Sodium/potassium-transporting ATPase subunit alpha-2; Na(+)/K(+) ATPase alpha-2 subunit; Sodium pump subunit alpha-2

Protein name: ATPase Na+/K+ transporting subunit alpha 2

Full length: 1020 amino acids

Entry name: AT1A2_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4275-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4275-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 477