Recombinant Human BAZ2B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UIF8

Gene Name: BAZ2B

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Met941

End Site: Asp1070

Coverage: 0.06

Isoelectric Point: 11

Core Sequence: MKQQEKIKRIQQIRMEKELRAQQILEAKKKKKEEAANAKLLEAEKRIKEKEMRRQQAVLLKHQERERRRQHMMLMKAMEARKKAEEKERLKQEKRDEKRLNKERKLEQRRLELEMAKELKKPNEDMCLAD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1476

Alternative protein names: Bromodomain adjacent to zinc finger domain protein 2B; hWALp4

Protein name: bromodomain adjacent to zinc finger domain 2B

Full length: 2168 amino acids

Entry name: BAZ2B_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10346-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10346-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 29994