Recombinant Human CACNA2D2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NY47

Gene Name: CACNA2D2

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Glu111

End Site: Phe250

Coverage: 0.13

Isoelectric Point: 4.5

Core Sequence: EPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFMENRRQDPTLLWQVF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: KIAA0558

Alternative protein names: Voltage-dependent calcium channel subunit alpha-2/delta-2; Voltage-gated calcium channel subunit alpha-2/delta-2) [Cleaved into: Voltage-dependent calcium channel subunit alpha-2-2; Voltage-dependent calcium channel subunit delta-2]

Protein name: calcium voltage-gated channel auxiliary subunit alpha2delta 2

Full length: 1150 amino acids

Entry name: CA2D2_HUMAN

• SKU: ASBPP-2848-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2848-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9254