Recombinant Human CCPG1 Protein

Recombinant Human CCPG1 Protein
SKU
ASBPP-2919-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULG6

Gene Name: CCPG1

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Tyr261

End Site: Lys480

Coverage: 0.30

Isoelectric Point: 7.5

Core Sequence: YLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLLTEAKMLKRELERERLVTTALRGELQQLSGSQLHGKSDSPNVYTEKKEIAILRERLTELERKLTFEQQRSDLWERLYVEAKDQNGKQGTDGKKKGGRGSHRAKNK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Pig - 87%, Cynomolgus monkey - 97%

Alternative gene names: CCP8; CPR8; KIAA1254

Alternative protein names: Cell cycle progression protein 1; Cell cycle progression restoration protein 8

Protein name: cell cycle progression 1

Full length: 757 amino acids

Entry name: CCPG1_HUMAN
More Information
SKU ASBPP-2919-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2919-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9236
Product information (PDF)
×
MSDS (PDF)
×