Recombinant Human CELSR1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NYQ6

Gene Name: CELSR1

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Arg2881

End Site: Asp3010

Coverage: 0.04

Isoelectric Point: 9

Core Sequence: RLKVETKVSVELHREEQGSHRGEYPPDQESGGAARLASSQPPEQRKGILKNKVTYPPPLTLTEQTLKGRLREKLADCEQSPTSSRTSSLGSGGPDCAITVKSPGREPGRDHLNGVAMNVRTGSAQADGSD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Pig - 69%, Cynomolgus monkey - 91%

Alternative gene names: CDHF9; FMI2

Alternative protein names: Cadherin EGF LAG seven-pass G-type receptor 1; Cadherin family member 9; Flamingo homolog 2; hFmi2

Protein name: cadherin EGF LAG seven-pass G-type receptor 1

Full length: 3014 amino acids

Entry name: CELR1_HUMAN

• SKU: ASBPP-2851-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2851-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9620