Recombinant Human CYP4F11 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HBI6

Gene Name: CYP4F11

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Ile271

End Site: Phe380

Coverage: 0.22

Isoelectric Point: 4.5

Core Sequence: IQERRCTLPTQGIDDFLKNKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDREPIEIEWDDLAQLPF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 88%, Pig - 91%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Cytochrome P450 4F11; CYPIVF11; 3-hydroxy fatty acids omega-hydroxylase CYP4F11; Docosahexaenoic acid omega-hydroxylase; Long-chain fatty acid omega-monooxygenase; Phylloquinone omega-hydroxylase CYP4F11

Protein name: cytochrome P450 family 4 subfamily F member 11

Full length: 524 amino acids

Entry name: CP4FB_HUMAN

Product panel: Enzyme

• SKU: ASBPP-2783-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2783-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 57834