Recombinant Human DACH1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UI36

Gene Name: DACH1

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Phe611

End Site: Asp740

Coverage: 0.18

Isoelectric Point: 9.5

Core Sequence: FPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 100%, Cynomolgus monkey - 99%

Alternative gene names: DACH

Alternative protein names: Dachshund homolog 1; Dach1

Protein name: dachshund family transcription factor 1

Full length: 758 amino acids

Entry name: DACH1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2896-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2896-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1602