Recombinant Human DCC Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P43146

Gene Name: DCC

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Lys1131

End Site: Ser1200

Coverage: 0.05

Isoelectric Point: 9.5

Core Sequence: KKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 93%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: IGDCC1

Alternative protein names: Netrin receptor DCC; Colorectal cancer suppressor; Immunoglobulin superfamily DCC subclass member 1; Tumor suppressor protein DCC

Protein name: DCC netrin 1 receptor

Full length: 1447 amino acids

Entry name: DCC_HUMAN

• SKU: ASBPP-292-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-292-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 1630