Recombinant Human EMCN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULC0

Gene Name: EMCN

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 39%

Start Site: Leu31

End Site: Ser180

Coverage: 0.67

Isoelectric Point: 9

Core Sequence: LVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNAS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 39%, Rat - 43%, Pig - 42%, Cynomolgus monkey - 78%

Alternative gene names: EMCN2; MUC14

Alternative protein names: Endomucin; Endomucin-2; Gastric cancer antigen Ga34; Mucin-14; MUC-14

Protein name: endomucin

Full length: 261 amino acids

Entry name: MUCEN_HUMAN

• SKU: ASBPP-2913-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2913-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51705